PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa003242
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ARR-B
Protein Properties Length: 505aa    MW: 57371.7 Da    PI: 6.264
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58696410PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.81.4e-24203256155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                k+r++Wt +LH++Fv+av+++ G ek  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Lsa003242 203 KARVVWTVDLHQKFVKAVNHI-GFEKVGPKKILDLMNVPWLTRENVASHLQKYRL 256
                68*******************.9*******************************8 PP

2Response_reg80.36.3e-27221301109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l+k  y ev+++  + eal+ll+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + ++ Ga 
     Lsa003242  22 VLVVDDDPTWLKILEKMLKKCSY-EVTTCGLAIEALDLLRERKdgFDIVISDVNMPDMDGFKLLEHVGLEM-ELPVIMMSVDGETSRVMRGVQHGAC 116
                   89*********************.***************999999**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ ++el++
     Lsa003242 117 DYLLKPIRMKELRN 130
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.8E-1422479IPR017053Response regulator B-type, plant
SuperFamilySSF521725.55E-3619159IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23006.8E-4419150No hitNo description
SMARTSM004487.0E-3220132IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.81521136IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.7E-2422131IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.46E-3023135No hitNo description
SuperFamilySSF466892.33E-17201260IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-27202261IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-22203256IPR006447Myb domain, plants
PfamPF002492.7E-7205255IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MAEGINGFSS PRADVFPAGL RVLVVDDDPT WLKILEKMLK KCSYEVTTCG LAIEALDLLR  60
ERKDGFDIVI SDVNMPDMDG FKLLEHVGLE MELPVIMMSV DGETSRVMRG VQHGACDYLL  120
KPIRMKELRN IWQHVYRKKI HEVRDSESHE CLEEILMMRN VSEQSDDGYL LSGGDITPGK  180
KRKDAEHNNY SDKDFIDHSS IKKARVVWTV DLHQKFVKAV NHIGFEKVGP KKILDLMNVP  240
WLTRENVASH LQKYRLYLTR LQKDDLKSTD SIKMQQNEGV QNTNSRIHEV DLKTTTTSLQ  300
TIESKKVLTG YAAKGQAQHN KASSSNIGIG NNHSFGSTQY PTFNSVLPTQ YSWDGGFTEI  360
QFKQEHNNQH FEVENGSGLL PTTVIQQHNQ ERGKRIANSN SGIKSSFGSS SYINIMPTFQ  420
PPDPWSLKDD HHHHSINNLD LSSILLQGQQ LSSSTNLDIQ KKGVAEYNDP EFPPSLYDAL  480
RFDYEYEYPP DSLEYPVIDQ GLFIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-19202261463ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267616.11e-168PREDICTED: two-component response regulator ARR11
SwissprotQ5N6V81e-132ORR26_ORYSJ; Two-component response regulator ORR26
TrEMBLA0A103XVV00.0A0A103XVV0_CYNCS; CheY-like superfamily
STRINGVIT_01s0010g02230.t011e-168(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-116response regulator 11